DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18814 and C06E4.3

DIOPT Version :9

Sequence 1:NP_652673.2 Gene:CG18814 / 59175 FlyBaseID:FBgn0042137 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_501156.1 Gene:C06E4.3 / 182326 WormBaseID:WBGene00015532 Length:277 Species:Caenorhabditis elegans


Alignment Length:211 Identity:53/211 - (25%)
Similarity:85/211 - (40%) Gaps:45/211 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKNVVYLGGFGGIG------------KKCVQELLKKQIKG--LAIFDLIVDDDLLAEWKKQHPDT 55
            ||..:..|...|||            |..|....:::::|  .|:.|..:.            |:
 Worm     7 GKVAIITGSSFGIGRATALLFAKEGAKVTVTGRSEERLQGSKQALLDAGIS------------DS 59

  Fly    56 EIFYQKMDITQKSDIDAAYKATAEKLGHFDVVVN--GSGLLDDRR----------IELTIQINLV 108
            .......|||..|..||....|.||.|..:::||  |:.:.|.:.          .|..:::|:.
 Worm    60 NFLIVPADITTSSGQDALISKTLEKFGQINILVNNAGASIADSQNRAGLDQGIDTYEKVLKLNVQ 124

  Fly   109 GVINSTLTALEYMDKSKGGRGGLIVNISSVAGLQPTPLM-AIYSTSKTGVTTFTRAMASPIHYAH 172
            .||..|.....::.|::|.    |||:||||.|:...:. ..|..:|..:..:||:.|  |....
 Worm   125 SVIEMTQKIRPHLAKTRGE----IVNVSSVAALKFAHVRNPYYPLAKAALDQYTRSAA--IDLIS 183

  Fly   173 SGVGFITICPGYTNTG 188
            .|:...|:.||...||
 Worm   184 QGIRVNTVNPGVVATG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18814NP_652673.2 NADB_Rossmann 6..248 CDD:304358 52/210 (25%)
adh_short 6..196 CDD:278532 52/210 (25%)
C06E4.3NP_501156.1 FabG 3..263 CDD:223959 53/211 (25%)
NADB_Rossmann 5..267 CDD:304358 53/211 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D553511at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.