DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18814 and Hpgd

DIOPT Version :9

Sequence 1:NP_652673.2 Gene:CG18814 / 59175 FlyBaseID:FBgn0042137 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_032304.2 Gene:Hpgd / 15446 MGIID:108085 Length:269 Species:Mus musculus


Alignment Length:267 Identity:85/267 - (31%)
Similarity:136/267 - (50%) Gaps:20/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLEGKNVVYLGGFGGIGKKCVQELLKKQIKGLAIFDLIVDDDLLAEWK-------KQHPDTEIF 58
            |.:.||..:..|...||||...:.||   :.|..:  .:||.:|.|..|       :..|...:|
Mouse     1 MHVNGKVALVTGAAQGIGKAFAEALL---LHGAKV--ALVDWNLEAGVKCKAALDEQFEPQKTLF 60

  Fly    59 YQKMDITQKSDIDAAYKATAEKLGHFDVVVNGSGLLDDRRIELTIQINLVGVINSTLTALEYMDK 123
            .| .|:..:..:...::...:..|..|::||.:|:.:::..|.|:|||||.||:.|...|:||.|
Mouse    61 VQ-CDVADQKQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEQTLQINLVSVISGTYLGLDYMSK 124

  Fly   124 SKGGRGGLIVNISSVAGLQPTPLMAIYSTSKTGVTTFTRAMASPIHYAHSGVGFITICPGYTNTG 188
            ..||.||:|:|:||:|||.|.....:|..||.|:..|||:.|...:...|||....||||:.:|.
Mouse   125 QNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNVICPGFVDTP 189

  Fly   189 ILKDIDKKTT---FPFYETRMRTVFSKVKGQTAEVCARNIVNAIE-TAKNGAVLMLELGE-IH-- 246
            ||:.|:|:..   :..|:.:::.:............|..::|.|| .|.|||::.:...: ||  
Mouse   190 ILESIEKEENMGQYIEYKDQIKAMMKFYGVLHPSTIANGLINLIEDDALNGAIMKITASKGIHFQ 254

  Fly   247 ELDIPNL 253
            :.||..|
Mouse   255 DYDISPL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18814NP_652673.2 NADB_Rossmann 6..248 CDD:304358 80/255 (31%)
adh_short 6..196 CDD:278532 68/196 (35%)
HpgdNP_032304.2 ADH_SDR_c_like 6..254 CDD:187584 80/253 (32%)
adh_short 6..199 CDD:278532 69/198 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841502
Domainoid 1 1.000 142 1.000 Domainoid score I4666
eggNOG 1 0.900 - - E2759_KOG4169
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 149 1.000 Inparanoid score I4369
Isobase 1 0.950 - 0.861353 Normalized mean entropy S2756
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42773
orthoMCL 1 0.900 - - OOG6_100916
Panther 1 1.100 - - LDO PTHR44229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.710

Return to query results.
Submit another query.