DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gdap2 and AT2G40600

DIOPT Version :9

Sequence 1:NP_724597.1 Gene:Gdap2 / 59173 FlyBaseID:FBgn0042135 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_030605.2 Gene:AT2G40600 / 818655 AraportID:AT2G40600 Length:257 Species:Arabidopsis thaliana


Alignment Length:214 Identity:68/214 - (31%)
Similarity:95/214 - (44%) Gaps:19/214 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NSNVDFKAFESSSSSCPV---KLDNLATWGGSQKT-DTRLPITDYSNLGGPR---HNRSPFPLCK 63
            :|:...:...||||...:   .::|..|...|..| .:||.....|...|..   .|.|...|.|
plant    19 SSSTILRPTSSSSSRASLISFAVNNFHTIASSSSTLSSRLTTVSSSMASGDEGAVFNLSDSSLLK 83

  Fly    64 DVNNRFVIWDGDMTTLEVDAITNTSDETLTESNSISERIFAVAGNQLR------EELSTTVKECR 122
            .:......|..|.::   |||.|.::|.:.........|...||.|||      .|:...|: |.
plant    84 ILKGDITKWSVDSSS---DAIVNPANERMLGGGGADGAIHRAAGPQLRAACYEVPEVRPGVR-CP 144

  Fly   123 TGDVRITRGYNLPAKYVLHTVAPAYREKFKTAAENTLHCCYRNVLCKAKELNLHTIALCNISAHQ 187
            ||:.|||.|:||||..|:|||.|.|.....  .:.:|...|:|.|..|||.|:..||...||...
plant   145 TGEARITPGFNLPASRVIHTVGPIYDSDVN--PQESLTNSYKNSLRVAKENNIKYIAFPAISCGI 207

  Fly   188 KSFPADVAAHIALRTIRRY 206
            ..:|.|.||.|.:.||:::
plant   208 YGYPFDEAAAIGISTIKQF 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gdap2NP_724597.1 YmdB 67..234 CDD:225021 51/146 (35%)
Macro_GDAP2_like 67..207 CDD:239233 51/146 (35%)
CRAL_TRIO_2 393..518 CDD:290435
AT2G40600NP_030605.2 Macro_Appr_pase_like 82..246 CDD:239236 52/151 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D937161at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11106
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.