DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gdap2 and macroh2a1

DIOPT Version :9

Sequence 1:NP_724597.1 Gene:Gdap2 / 59173 FlyBaseID:FBgn0042135 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001035451.1 Gene:macroh2a1 / 678613 ZFINID:ZDB-GENE-060421-4796 Length:357 Species:Danio rerio


Alignment Length:173 Identity:41/173 - (23%)
Similarity:75/173 - (43%) Gaps:22/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VNNRFVIWDGDMTTLEVDAITNTSDETLTESNSISERIFAVAGNQLREELSTTVKECRTGD---- 125
            :..:..:...|:.::|.:|:.:.::.:......:...:..:.|    :|||..|.|.|..:    
Zfish   181 LGQKLQVVQADIASIESEAVVHPTNSSFYMGGEVGSALEKIGG----KELSDAVLELRKSNGPLE 241

  Fly   126 ---VRITRGYNLPAKYVLHTVAPAYREKFKTAAENTLHCCYRNVLCKAKELNLHTIALCNISAHQ 187
               ..|:.|:.||||:|:|..:||:.   ....|..|....:|.|..|.|..|.::|..:|.:.:
Zfish   242 VAGAAISSGFGLPAKFVIHCNSPAWG---SDQCEEMLEKTVKNCLALADEQKLRSVAFPSIGSGR 303

  Fly   188 KSFPADVAAHIALRTIRRYLDKCTLQVVILCVGSSERGTYEVL 230
            ..||...||.:.|:.|..|.        :..:.||.:..|.||
Zfish   304 NGFPKQKAAQLILKAISSYF--------VTTMSSSIKTVYFVL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gdap2NP_724597.1 YmdB 67..234 CDD:225021 41/171 (24%)
Macro_GDAP2_like 67..207 CDD:239233 35/146 (24%)
CRAL_TRIO_2 393..518 CDD:290435
macroh2a1NP_001035451.1 H2A 5..117 CDD:238029
Macro_H2A_like 170..349 CDD:239232 41/173 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.