DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gdap2 and MACROH2A2

DIOPT Version :9

Sequence 1:NP_724597.1 Gene:Gdap2 / 59173 FlyBaseID:FBgn0042135 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_061119.1 Gene:MACROH2A2 / 55506 HGNCID:14453 Length:372 Species:Homo sapiens


Alignment Length:246 Identity:52/246 - (21%)
Similarity:94/246 - (38%) Gaps:41/246 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ESSSSSCPVKLDNLATWG--GSQKTDTRLPITDY------SNLGGPRHNRSP------FPLCKD- 64
            |:..|..|.|....||.|  |.:|:....|.|..      |:..|..::.|.      |.:... 
Human   125 ETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSK 189

  Fly    65 ---VNNRFVIWDGDMT---TLEVDAITNTSDETLTESNSISERIFAVAGNQLREELSTTVKECR- 122
               :..:..:...|::   ::.|:.|.:.:...:.....|.:.:....|.:..|    ||||.| 
Human   190 SLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLE----TVKELRK 250

  Fly   123 ------TGDVRITRGYNLPAKYVLHTVAPAY-REKFKTAAENTLHCCYRNVLCKAKELNLHTIAL 180
                  ..:..:::...|.||:|:|...|.: .:|.:...|.|:    :|.|..|::..|.::|.
Human   251 SQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETI----KNCLSAAEDKKLKSVAF 311

  Fly   181 CNISAHQKSFPADVAAHIALRTIRRYLDKCTL----QVVILCVGSSERGTY 227
            ....:.:..||...||.:.|:.|..:.|..:.    .|..|...|...|.|
Human   312 PPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIY 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gdap2NP_724597.1 YmdB 67..234 CDD:225021 37/176 (21%)
Macro_GDAP2_like 67..207 CDD:239233 31/150 (21%)
CRAL_TRIO_2 393..518 CDD:290435
MACROH2A2NP_061119.1 H2A 5..117 CDD:238029
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..182 14/56 (25%)
Macro_H2A-like 178..368 CDD:394875 38/193 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.