DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gdap2 and macrod1

DIOPT Version :9

Sequence 1:NP_724597.1 Gene:Gdap2 / 59173 FlyBaseID:FBgn0042135 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001004573.2 Gene:macrod1 / 447834 ZFINID:ZDB-GENE-040912-100 Length:327 Species:Danio rerio


Alignment Length:203 Identity:74/203 - (36%)
Similarity:110/203 - (54%) Gaps:8/203 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LPITDYSNLGGPRHNRSPFPLC---KDVNNRFVIWDGDMTTLEVDAITNTSDETLTESNSISERI 102
            :|:.|.. :..|..:.|..|.|   :::|.:..::.||:|.||:||:.|.:::||.....:...|
Zfish   119 IPLEDVP-VWSPSGDSSCKPRCEVNEELNMKVSLFGGDITKLEIDAVANAANKTLLGGGGVDGAI 182

  Fly   103 FAVAGNQLREELSTTVKECRTGDVRITRGYNLPAKYVLHTVAPAYREKFKTAAENTLHCCYRNVL 167
            ...||..||:|.: |:..|.||:.:||..|.|||:||:|||.|...:......|..|..||.|.|
Zfish   183 HRGAGPLLRKECA-TLNGCETGEAKITGAYGLPARYVIHTVGPIVHDSVGEREEEALRNCYYNCL 246

  Fly   168 CKAKELNLHTIALCNISAHQKSFPADVAAHIALRTIRRYLDKC--TLQVVILCVG-SSERGTYEV 229
            ..|.:.:|.|:|...||.....:|.|.|..:||:|:|.||::.  .|..||.||. .|::..||.
Zfish   247 HTATKHHLRTVAFPCISTGVYGYPPDQAVEVALKTVRDYLEQNPEKLDRVIFCVFLKSDKQLYEN 311

  Fly   230 LAPLYFPR 237
            |.|.||||
Zfish   312 LLPAYFPR 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gdap2NP_724597.1 YmdB 67..234 CDD:225021 63/169 (37%)
Macro_GDAP2_like 67..207 CDD:239233 51/139 (37%)
CRAL_TRIO_2 393..518 CDD:290435
macrod1NP_001004573.2 Macro_Appr_pase_like 148..314 CDD:239236 62/166 (37%)
YmdB 154..313 CDD:225021 61/159 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D564346at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.