Sequence 1: | NP_724597.1 | Gene: | Gdap2 / 59173 | FlyBaseID: | FBgn0042135 | Length: | 540 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001004573.2 | Gene: | macrod1 / 447834 | ZFINID: | ZDB-GENE-040912-100 | Length: | 327 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 74/203 - (36%) |
---|---|---|---|
Similarity: | 110/203 - (54%) | Gaps: | 8/203 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 LPITDYSNLGGPRHNRSPFPLC---KDVNNRFVIWDGDMTTLEVDAITNTSDETLTESNSISERI 102
Fly 103 FAVAGNQLREELSTTVKECRTGDVRITRGYNLPAKYVLHTVAPAYREKFKTAAENTLHCCYRNVL 167
Fly 168 CKAKELNLHTIALCNISAHQKSFPADVAAHIALRTIRRYLDKC--TLQVVILCVG-SSERGTYEV 229
Fly 230 LAPLYFPR 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gdap2 | NP_724597.1 | YmdB | 67..234 | CDD:225021 | 63/169 (37%) |
Macro_GDAP2_like | 67..207 | CDD:239233 | 51/139 (37%) | ||
CRAL_TRIO_2 | 393..518 | CDD:290435 | |||
macrod1 | NP_001004573.2 | Macro_Appr_pase_like | 148..314 | CDD:239236 | 62/166 (37%) |
YmdB | 154..313 | CDD:225021 | 61/159 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2110 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D564346at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |