DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gdap2 and Macroh2a2

DIOPT Version :9

Sequence 1:NP_724597.1 Gene:Gdap2 / 59173 FlyBaseID:FBgn0042135 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001129279.1 Gene:Macroh2a2 / 361844 RGDID:1561371 Length:372 Species:Rattus norvegicus


Alignment Length:162 Identity:36/162 - (22%)
Similarity:66/162 - (40%) Gaps:20/162 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 TLEVDAITNTSDETLTESNSISERIFAVAGNQLREELSTTVKECR-------TGDVRITRGYNLP 135
            ::.|:.|.:.:...:.....|.:.:....|.:..|    ||||.|       ..:..:::...|.
  Rat   209 SMRVEGIVHPTTAEIDLKEEIGKALEKAGGKEFLE----TVKELRKSQGPLEVAEAAVSQSSGLA 269

  Fly   136 AKYVLHTVAPAY-REKFKTAAENTLHCCYRNVLCKAKELNLHTIALCNISAHQKSFPADVAAHIA 199
            ||:|:|...|.: .:|.:...|.|:    :|.|..|::..|.::|.....:.:..||...||.:.
  Rat   270 AKFVIHCHIPQWGSDKCEEQLEETI----KNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVT 330

  Fly   200 LRTIRRYLDKCT----LQVVILCVGSSERGTY 227
            |:.|..:.|..:    ..|..|...|...|.|
  Rat   331 LKAISAHFDDSSSSSLKNVYFLLFDSESIGIY 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gdap2NP_724597.1 YmdB 67..234 CDD:225021 36/162 (22%)
Macro_GDAP2_like 67..207 CDD:239233 30/136 (22%)
CRAL_TRIO_2 393..518 CDD:290435
Macroh2a2NP_001129279.1 H2A 5..117 CDD:238029
Macro_H2A-like 178..368 CDD:394875 36/162 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.