DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gdap2 and Macroh2a1

DIOPT Version :9

Sequence 1:NP_724597.1 Gene:Gdap2 / 59173 FlyBaseID:FBgn0042135 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_036145.1 Gene:Macroh2a1 / 26914 MGIID:1349392 Length:372 Species:Mus musculus


Alignment Length:160 Identity:39/160 - (24%)
Similarity:70/160 - (43%) Gaps:16/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DMTTLEVDAITNTSDETLTESNSISERIFAVAGNQLRE---ELSTTVKECRTGDVRITRGYNLPA 136
            ::...||:||.|.::..:...:.:...:....|.:..|   ||.............|:.|:.|||
Mouse   206 NLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAISAGHGLPA 270

  Fly   137 KYVLHTVAPAY-REKFKTAAENTLHCCYRNVLCKAKELNLHTIALCNISAHQKSFPADVAAHIAL 200
            |:|:|..:|.: .:|.:...|.|:    :|.|..|.:..|.:||..:|.:.:..||...||.:.|
Mouse   271 KFVIHCNSPVWGADKCEELLEKTV----KNCLALADDRKLKSIAFPSIGSGRNGFPKQTAAQLIL 331

  Fly   201 RTIRRYLDKCTLQVVILCVGSSERGTYEVL 230
            :.|..|.        :..:.||.:..|.:|
Mouse   332 KAISSYF--------VSTMSSSIKTVYFML 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gdap2NP_724597.1 YmdB 67..234 CDD:225021 39/160 (24%)
Macro_GDAP2_like 67..207 CDD:239233 34/135 (25%)
CRAL_TRIO_2 393..518 CDD:290435
Macroh2a1NP_036145.1 H2A 5..117 CDD:238029
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..180
Macro_H2A_like 178..364 CDD:239232 39/160 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.