DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gdap2 and B0035.3

DIOPT Version :9

Sequence 1:NP_724597.1 Gene:Gdap2 / 59173 FlyBaseID:FBgn0042135 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_502127.1 Gene:B0035.3 / 178044 WormBaseID:WBGene00007106 Length:203 Species:Caenorhabditis elegans


Alignment Length:161 Identity:53/161 - (32%)
Similarity:74/161 - (45%) Gaps:2/161 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FPLCKDVNNRFVIWDGDMTTLEVDAITNTSDETLTESNSISERIFAVAGNQLREELSTTVKECRT 123
            |.:.|:|..|..:||||:|.|.||||.|.::..|.....:...|...||.:..:|.......|..
 Worm    16 FKVAKNVLGRISVWDGDITKLSVDAIVNAANSRLAGGGGVDGAIHRAAGRKQLQEECQQYNGCAV 80

  Fly   124 GDVRITRGYNL-PAKYVLHTVAPAYREKFKTAAENTLHCCYRNVLCKAKELNLHTIALCNISAHQ 187
            ||..||.|.|: ..|.::|||.|.............|..|||..|..|.|..:.:||.|.||...
 Worm    81 GDAVITSGCNINHIKKIIHTVGPQVYGNVTDERRENLVACYRTSLDIAIENGMKSIAFCCISTGV 145

  Fly   188 KSFPADVAAHIALRTIRRYLDK-CTLQVVIL 217
            ..:|.|.||......:..||:| .|::.::|
 Worm   146 YGYPNDDAAKTVTNFLTEYLEKNDTIERIVL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gdap2NP_724597.1 YmdB 67..234 CDD:225021 50/153 (33%)
Macro_GDAP2_like 67..207 CDD:239233 45/140 (32%)
CRAL_TRIO_2 393..518 CDD:290435
B0035.3NP_502127.1 PRK00431 25..190 CDD:234759 50/152 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I7911
eggNOG 1 0.900 - - E1_COG2110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D564346at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.