DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and PFA4

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_014640.1 Gene:PFA4 / 854159 SGDID:S000005363 Length:378 Species:Saccharomyces cerevisiae


Alignment Length:355 Identity:81/355 - (22%)
Similarity:127/355 - (35%) Gaps:118/355 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WPKEKLEQFLFLFILCGLPAIYYVLMEII-LPELSDYWSPGYVFQLLLGLFLFSNVMSNYVMCIL 73
            ||...:....||....|..|.|::|...: :|:       ...|:     |..|.:..:|.:.|.
Yeast     7 WPWLGIAIPTFLISFIGYGAHYFILSNFLSVPK-------QITFE-----FCLSMIWLSYYLAIC 59

  Fly    74 VDP-------SIDPKLMKNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTG 131
            .:|       ...|.:.:|            .|.||....|.||.||:.|..||||.||||.:|.
Yeast    60 TNPGRPLPNYKPPPDIWRN------------FCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTM 112

  Fly   132 CCIGHENYRYFFYFLIYFFLSCMISLTSSSIF------IYVLHGGRY---------QLFMLTHPA 181
            .|:|..||.:|..||.:      |.:|:|.:|      ||.:...|:         :|..||..:
Yeast   113 NCVGFANYPHFLRFLFW------IIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISS 171

  Fly   182 PNSAYFNSLIIRIIYFKLPDIYELVFTLVFVLLWIGVCVATYVAYDQW----------------- 229
            |    .||.::            |..|::|:.......:......:.|                 
Yeast   172 P----LNSFVL------------LTITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQK 220

  Fly   230 -----------SRGYF--------------CYDFELQNIPFDRKLRRNFKTFLGRRMKWTWISGF 269
                       ||.:.              .:| ||.|.|:|..|..|...:||....|.|..| 
Yeast   221 LIDNTWRIYPESRSFQNKKDAEEHLTKKRPRFD-ELVNFPYDFDLYTNALLYLGPIHLWLWPYG- 283

  Fly   270 VPSQLDHDGFDLDPDNERVADWCSETTIKD 299
            ||:. |.:.|   |.| .::.:.:.::::|
Yeast   284 VPTG-DGNNF---PKN-GISKYEANSSLED 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 20/45 (44%)
PFA4NP_014640.1 COG5273 1..344 CDD:227598 81/355 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.