DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and PFA5

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_010747.1 Gene:PFA5 / 852070 SGDID:S000002867 Length:374 Species:Saccharomyces cerevisiae


Alignment Length:338 Identity:80/338 - (23%)
Similarity:119/338 - (35%) Gaps:117/338 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IWPKEKLEQFLFLFILCGLPAIYYVLMEIILPELSDYWSPGYVFQLLLGLFLFSNVMSNYVMCIL 73
            ||        |.:.||.|.....:|...:|||..|:..:              ||...|  ..:.
Yeast    70 IW--------LQIVILVGPGTQPHVAPFLILPIASEEKT--------------SNTSQN--TSVE 110

  Fly    74 VDPSIDPKLMKNQLVRGQHSEDWHE----CDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCI 134
            .|..:.||.         :..|.|.    |.:|..|...|:.|..:.|.|:...||:|.:.|..|
Yeast   111 YDAVVPPKC---------YQSDPHGYPIWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVI 166

  Fly   135 GHENYRYFFYFLIYFFLSCMISLTSSSIFIYVL--HGGRYQLFMLTHPAPNSAYFNSLIIRIIYF 197
            |.:|||.|..|..||....:|...|..::|.::  |...|        :||   .|:.||.    
Yeast   167 GRDNYRLFVQFAAYFSTLLLIMWVSICVYIRIITQHNHNY--------SPN---LNANIIS---- 216

  Fly   198 KLPDIYELVFTLVFVLL-WI--GVCVAT---YVAYDQWS--------------RGYFCYDFELQN 242
                      ||||.:| |:  ...:|:   |::.::.|              |..|||..|...
Yeast   217 ----------TLVFAILGWLLTASLLASSIFYMSQNKTSLEAIIDSKRKKFGTRKIFCYYSEANK 271

  Fly   243 ----IPFDR----------KLRRNFKTFLGRRMKWTWISGFVP------SQLDHDGFD------- 280
                :.|||          .:..|.|.|:|..: ..||   :|      |:...||..       
Yeast   272 LRFVVEFDRSEFHSFWDKKSILANIKDFMGSNI-LMWI---IPLGKPYTSRCKSDGKSGSKTTLV 332

  Fly   281 --LDPDNERVADW 291
              |.|..|.::|:
Yeast   333 EILGPYEETLSDY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 15/49 (31%)
PFA5NP_010747.1 COG5273 9..335 CDD:227598 76/326 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.