DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and SWF1

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_010411.1 Gene:SWF1 / 851704 SGDID:S000002533 Length:336 Species:Saccharomyces cerevisiae


Alignment Length:131 Identity:42/131 - (32%)
Similarity:61/131 - (46%) Gaps:32/131 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LFLFSNVMSNYVMCILVDPSIDPKLMKNQLVRGQHSEDWH-------------------ECDKCG 103
            |||...::   ::.|::.|.:...::. .:.|.:.|:| |                   :|..|.
Yeast    81 LFLLERIL---IVPIIILPPVALGILA-MVSRAEDSKD-HKSGSTEEYPYDYLLYYPAIKCSTCR 140

  Fly   104 ILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLI-------YFFLSC-MISLTSS 160
            |:.|.||:||..|..|||:.||||.:...|||..||..|:.|||       |.||.. .|||.|:
Yeast   141 IVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWYISLNST 205

  Fly   161 S 161
            |
Yeast   206 S 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 22/64 (34%)
SWF1NP_010411.1 COG5273 22..336 CDD:227598 42/131 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.