DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and ERF2

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_013347.1 Gene:ERF2 / 850947 SGDID:S000004236 Length:359 Species:Saccharomyces cerevisiae


Alignment Length:191 Identity:55/191 - (28%)
Similarity:86/191 - (45%) Gaps:32/191 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RFRSLKNIWPKEKLEQFLFLFILCGLPAIYYVLMEIILPELSDYW--SPGYVFQLLLGLFLFSNV 64
            |||::|...|   |...:.|.|:|.:     ||..|.  |....|  ..||...::...:.:...
Yeast    66 RFRTVKGAKP---LWLGVLLAIVCPM-----VLFSIF--EAHKLWHTQNGYKVLVIFFYYFWVIT 120

  Fly    65 MSNYVMCILVDPSIDPKLMKNQLVRGQHS--EDWHE------------------CDKCGILAPPR 109
            :::::.....||.:.|:.:....:|..:.  ::::.                  |..|.|..|||
Yeast   121 LASFIRTATSDPGVLPRNIHLSQLRNNYQIPQEYYNLITLPTHSSISKDITIKYCPSCRIWRPPR 185

  Fly   110 SRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMISLTSSSIFIYVLHGG 170
            |.||..|.|||::.||||.:...|||..|||:|..||:...||.:|.||:.:|.|....||
Yeast   186 SSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVILLTNCAIHIARESGG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 20/65 (31%)
ERF2NP_013347.1 COG5273 47..359 CDD:227598 55/191 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345811
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.