DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and AT3G56930

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_191252.1 Gene:AT3G56930 / 824860 AraportID:AT3G56930 Length:477 Species:Arabidopsis thaliana


Alignment Length:189 Identity:48/189 - (25%)
Similarity:87/189 - (46%) Gaps:24/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PSIDPKLMKNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYR 140
            |:|....:|:..|.| |:.....||.|.:..|||:.||..|..||...||||.:.|.|||..|||
plant   126 PNIRIPRVKDVTVNG-HTVKVKFCDTCLLYRPPRASHCSICNNCVQRFDHHCPWVGQCIGVRNYR 189

  Fly   141 YFFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDIYEL 205
            :||.|:          .||:::.|||.......:|. .|.....:.:.::...:       :.::
plant   190 FFFMFI----------STSTTLCIYVFAFSWLNIFQ-RHMDEKISIWKAISKDV-------LSDI 236

  Fly   206 VFTLVFVLLWIGVCVATYVAY----DQWSRGYFCYDFELQNIPFDRKLRRN-FKTFLGR 259
            :....|:.:|....:..:.:|    :|.:...|.|.::.:..|:::.:..| ::.||.:
plant   237 LIVYCFITVWFVGGLTIFHSYLICTNQTTYENFRYRYDKKENPYNKGILGNIWEIFLSK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 20/45 (44%)
AT3G56930NP_191252.1 DHHC 146..271 CDD:396215 37/142 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.