DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and AT3G18620

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_188492.2 Gene:AT3G18620 / 821393 AraportID:AT3G18620 Length:345 Species:Arabidopsis thaliana


Alignment Length:277 Identity:79/277 - (28%)
Similarity:116/277 - (41%) Gaps:68/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LFILC-GLPAIYYVLMEIILPELSDYWSPGYVFQLLLGLF-------LFSNVMSNYVMCILVDPS 77
            ||::| |:.|.|.||..|               .|..|:|       |..:.:|.:   |||...
plant    77 LFVICGGIWAAYPVLFSI---------------SLACGIFHSVTTATLAISTLSTF---ILVAFK 123

  Fly    78 IDPKLMKNQLVRGQHS-------EDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIG 135
            ...|  ...::.|.|.       .::..|:.|.....||:.|||.||:|||..||||.|.|.|:|
plant   124 CAGK--PTNILYGTHPGVGNGALNNYTFCNYCSKPKSPRTHHCRTCGMCVLDMDHHCPFIGNCVG 186

  Fly   136 HENYRYFFYFLIYFFLSCMISLTSSSIF-IYVL--------HGGRYQLFMLTHPAPNSAYFNSL- 190
            ..|::||..|||    |.:||.:.:::. :|.|        .|..|     .....:.|:.||: 
plant   187 AGNHKYFIAFLI----SAVISTSYAAVMCVYTLIHILPPIEKGAAY-----ASDVAHVAHGNSIS 242

  Fly   191 IIRII-YFKLPDIYELVF----TLVFVLLWI-GVCVATYVAYDQWSRGYFCYD-------FELQN 242
            |:|:: ...|..|...||    :||.|.|:: .|.||..::...|.:..:.|:       ...|.
plant   243 ILRVVKNICLTYIANAVFISVRSLVLVYLFVASVSVAIGLSVLLWQQLSYIYEGKTYLSHLSSQG 307

  Fly   243 IPFD-RKLRRNFKTFLG 258
            ...| .|..||..||.|
plant   308 TEEDGEKSCRNLLTFFG 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 21/52 (40%)
AT3G18620NP_188492.2 DHHC 76..>219 CDD:418707 51/165 (31%)
DHHC 149..298 CDD:396215 51/157 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D863846at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.