DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and AT3G09320

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_566348.1 Gene:AT3G09320 / 820088 AraportID:AT3G09320 Length:286 Species:Arabidopsis thaliana


Alignment Length:300 Identity:71/300 - (23%)
Similarity:110/300 - (36%) Gaps:78/300 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PGYVFQLLLGLFLFSNVMS-----------------------------NYVMCILVDPS------ 77
            |..|..|::|...|::|.:                             ||.:.:..||.      
plant    11 PVTVVMLVIGFIYFASVFTFIDRWFSLTSSPGIANAAAFTALALMCIYNYSIAVFRDPGRVPLNY 75

  Fly    78 ----IDPKLMKNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHEN 138
                .||:...:::.|  ...|...|.||....|||:.|||.|..|||..||||.:...|:||.|
plant    76 MPDVEDPESPVHEIKR--KGGDLRYCQKCSHFKPPRAHHCRVCKRCVLRMDHHCIWINNCVGHTN 138

  Fly   139 YRYFFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDIY 203
            |:.||.|::|...:|:.||        ||..|...:..........:|..::.:...:..:|   
plant   139 YKVFFVFVVYAVTACVYSL--------VLLVGSLTVEPQDEEEEMGSYLRTIYVISAFLLIP--- 192

  Fly   204 ELVFTLVFVLLWIGVCV---ATYVAYDQWSRGYFCYD--FELQNIPFDRKLRRNFKTFLGRRMKW 263
             |...|..:|.|....:   .|.:.|.:..|..:..:  .::...|:|.....|....||..:  
plant   193 -LSIALGVLLGWHIYLILQNKTTIEYHEGVRAMWLAEKGGQVYKHPYDIGAYENLTLILGPNI-- 254

  Fly   264 TWISGFVPSQLDHDG--------FDLDPDNERVADWCSET 295
              :|...|:. .|.|        ||..||:       |||
plant   255 --LSWLCPTS-RHIGSGVRFRTAFDSIPDS-------SET 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 21/45 (47%)
AT3G09320NP_566348.1 DHHC 94..217 CDD:396215 40/134 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.