DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and ZDHHC14

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_016866796.1 Gene:ZDHHC14 / 79683 HGNCID:20341 Length:506 Species:Homo sapiens


Alignment Length:197 Identity:48/197 - (24%)
Similarity:76/197 - (38%) Gaps:64/197 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LPELSDYWSPGYVFQ--------------LLLGLFLFSNVMSNYVMCILVDPSIDPKL------- 82
            ||.:|. |..|.:.:              .:.|: ||..||...:.....||.:.|:.       
Human    86 LPTISS-WLAGCLLRSCPYLAVKITPAIPAVAGI-LFFFVMGTLLRTSFSDPGVLPRATPDEAAD 148

  Fly    83 ---------------------MKNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHH 126
                                 .|..::.|| :.....|..|.|..|||:.||..|..||...|||
Human   149 LERQIDIANGTSSGGYRPPPRTKEVIINGQ-TVKLKYCFTCKIFRPPRASHCSLCDNCVERFDHH 212

  Fly   127 CFFTGCCIGHENYRYFFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTH---PAPNSAYFN 188
            |.:.|.|:|..|||:|:.|:        :||:..::||:.        |::||   .:..:.:.|
Human   213 CPWVGNCVGKRNYRFFYMFI--------LSLSFLTVFIFA--------FVITHVILRSQQTGFLN 261

  Fly   189 SL 190
            :|
Human   262 AL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 18/45 (40%)
ZDHHC14XP_016866796.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.