DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and zdhhc5b

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_009289570.1 Gene:zdhhc5b / 792560 ZFINID:ZDB-GENE-101117-1 Length:658 Species:Danio rerio


Alignment Length:169 Identity:53/169 - (31%)
Similarity:69/169 - (40%) Gaps:44/169 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LFLFILCGLPAIYYVLMEIILPELSDYWSPGYVFQLLLGLFLFSNVMSNYVMCILVDPSIDPK-- 81
            |||...|              |.||:.:|.   |..|..:.:|...::|:.|...:||.:.|:  
Zfish    41 LFLCFTC--------------PWLSEKFSS---FIPLYNVVVFLFTLANFCMATFMDPGVFPRAE 88

  Fly    82 ------------LMKNQLVRG-QHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCC 133
                        |.|...||| |....|  |..|....|||..||..|..||...||||.:...|
Zfish    89 EDEDKEDDFRAPLYKTVEVRGIQVRMKW--CSTCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNC 151

  Fly   134 IGHENYRYFFYFLIYFFLSCMISLTSSSIF----IYVLH 168
            ||..||||||.||:...:..|      .:|    :|:||
Zfish   152 IGRRNYRYFFLFLLSLTVHIM------DVFGFSLLYILH 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 18/45 (40%)
zdhhc5bXP_009289570.1 DHHC 110..235 CDD:396215 32/83 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.