DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and zdhhc3b

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001071225.1 Gene:zdhhc3b / 777709 ZFINID:ZDB-GENE-061110-19 Length:300 Species:Danio rerio


Alignment Length:308 Identity:72/308 - (23%)
Similarity:116/308 - (37%) Gaps:80/308 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RFRSLKNIWPKEKLEQFLFLFILCG-----------LPAIYYVLMEIILPELSDYWS--PGYVFQ 53
            |..|..::|         |:...||           |.|.:.|:..::||..|..:|  .|.:|.
Zfish    30 RAHSAHDMW---------FIRDGCGIVCAVITWLLVLYAEFVVVFVMLLPARSLLYSFINGALFN 85

  Fly    54 LLLGLFLFSNVMSNYVMCILVDPSIDPK-------LMKNQLVRGQHSEDWHECDKCGILAPPRSR 111
            .|..|.|.|::.:   ||  .||...||       :...||..||..   ::|.||..:.|.|:.
Zfish    86 SLAFLALASHLRA---MC--TDPGAVPKGNATKEFIESLQLKPGQVV---YKCPKCCSIKPDRAH 142

  Fly   112 HCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMISLTSSSI-FIYVLHGGRYQLF 175
            ||..|..|:...||||.:...|:|..|.:||..|.:|..|..:.:|...:. |::.......:..
Zfish   143 HCSVCKRCIKKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALLMVAFHFVFCFEEDWAKCS 207

  Fly   176 MLTHPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVFVLLWIGVCVATYVAYDQ------------ 228
            ..:.||       ::|:.|:.     .:|.:..|:|..:..|..|.: :..|:            
Zfish   208 SFSPPA-------TVILLILL-----CFEALLFLIFTAVMFGTQVHS-ICNDETGIEQLKKEERR 259

  Fly   229 WSRGYFCYDFELQNIPFDRKLRRNFKTFLGRRMKWTWISGFVPSQLDH 276
            |::               |....|.|...|.....:|:|.|...  ||
Zfish   260 WAK---------------RSKWMNMKVVFGHPFSMSWMSPFATP--DH 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 15/45 (33%)
zdhhc3bNP_001071225.1 zf-DHHC 130..256 CDD:279823 33/138 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.