DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_082655.1 Gene:Zdhhc4 / 72881 MGIID:1920131 Length:343 Species:Mus musculus


Alignment Length:231 Identity:62/231 - (26%)
Similarity:95/231 - (41%) Gaps:47/231 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QFLFLFILCGLPAIYYVLMEI--ILPELSDYWSPGYVFQ----LLLGLFLFSNVMSNYVMCILVD 75
            :|...::|  ||   |||:.:  :...|:...:||.:.:    .||.::.|.:||          
Mouse    95 EFSLPYLL--LP---YVLLSVNLVFFTLTCAANPGTITKANESFLLQVYKFDDVM---------- 144

  Fly    76 PSIDPKLMKNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYR 140
                  ..||.           .|..|.:..|.||:|||.|..||...||||.:...|||..|.|
Mouse   145 ------FPKNS-----------RCPTCDLRKPARSKHCRLCDRCVHRFDHHCVWVNNCIGAWNTR 192

  Fly   141 YFFYFLIYFFLSCMISLTSSSIFI--YVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDI- 202
            ||..:|:....|.....|.::.|:  .|.....||...|.......|.....:|:.::...|.| 
Mouse   193 YFLIYLLTLTASAATIATVTAAFLLRLVTVSDLYQETYLDDVGHFQAVDTVFLIQHLFLAFPRIV 257

  Fly   203 YELVFTLVFVLLWIG-VCVATYVA-----YDQWSRG 232
            :.|.|.:|..:|..| :|.|.|:|     .::|.:|
Mouse   258 FLLGFVIVLSMLLAGYLCFALYLAATNQTTNEWYKG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 18/45 (40%)
Zdhhc4NP_082655.1 DHHC 151..292 CDD:396215 44/140 (31%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.