DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and Zdhhc11

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_081980.1 Gene:Zdhhc11 / 71164 MGIID:1918414 Length:347 Species:Mus musculus


Alignment Length:261 Identity:54/261 - (20%)
Similarity:109/261 - (41%) Gaps:55/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IYYVLMEII-----LPELSDYWSPGYVFQLLL-GLFLFSNVMSNYVMCILVDPS-IDPKLMKN-- 85
            |.|:.|.|:     :|.|...|.  |...::: |:|:|..::  :::.|.:||: .:.:|.|:  
Mouse    50 ITYLAMSIVTFGIFIPFLPYSWK--YAANIVMGGVFIFHLIV--HLIAITIDPADTNVRLKKDYT 110

  Fly    86 ------------QLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHEN 138
                        .:::.|:      |..|.:.|..:::||..|..||...||||.:...|:|..|
Mouse   111 QPVPAFDRSKHTHVIQNQY------CHLCEVTASKKAKHCSACNKCVSGFDHHCKWLNNCVGRRN 169

  Fly   139 YRYFF------------------YFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTHPAP-NS 184
            |.:||                  |..|.:|:: ...|.:..::..::....:.||:...|.| .:
Mouse   170 YWFFFWSVASAAVGILGVMIILCYICIQYFVN-PDELRTDPLYKEIISENTWLLFLSLWPVPVKT 233

  Fly   185 AYFNSLIIRIIYFKLPDIYELVFTLVFVLLWIGVCVAT--YVAYDQWSRGYFCYDFELQNIPFDR 247
            ....|:.:..:...:.....|...|:|.|..|...::|  |:...::.:.  .:..|.:.:|..:
Mouse   234 PIVLSIAVMALLLAIASFVMLGHLLIFHLYLITKNMSTFDYLMKTRFKKN--LHPAEEKELPLQK 296

  Fly   248 K 248
            |
Mouse   297 K 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 14/45 (31%)
Zdhhc11NP_081980.1 zf-DHHC 123..277 CDD:279823 35/160 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 291..332 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.