DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and Zdhhc2

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_848482.1 Gene:Zdhhc2 / 70546 MGIID:1923452 Length:366 Species:Mus musculus


Alignment Length:315 Identity:70/315 - (22%)
Similarity:100/315 - (31%) Gaps:105/315 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YWSPGYVFQLLLGLFLFSNV-------MSN---YVMCIL---------------------VDPSI 78
            ||.|.....||||...::..       |.|   .|:|::                     ::||.
Mouse    18 YWIPVVFISLLLGWSYYAYAIQLCIVSMENIGEQVVCLMAYHLLFAMFVWSYWKTIFTLPMNPSK 82

  Fly    79 DPKLM---KNQLVRGQHSEDWHE----------------------CDKCGILAPPRSRHCRKCGV 118
            :..|.   |..|.|....|...|                      ||:|.::.|.|..||..|..
Mouse    83 EFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLIKPDRCHHCSVCDK 147

  Fly   119 CVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCM-ISLTSSSIFIYVLHGGRYQLFMLTHPAP 182
            |:|..||||.:...|:|..||::|..||.|..|.|: |:.|....||.....|            
Mouse   148 CILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLFIAATDLQYFIRFWTNG------------ 200

  Fly   183 NSAYFNSLIIRIIYFKLPDI---YELVFTLVFVLLWIGVCVATYVAYDQWSRGYFCYDFELQNIP 244
                            |||.   :.::| |.|......|.:::...|..|.........|....|
Mouse   201 ----------------LPDTQAKFHIMF-LFFAAAMFSVSLSSLFGYHCWLVSKNKSTLEAFRNP 248

  Fly   245 ----------FDRKLRRNFKTFLGRRMKWTWISGFVPSQLDHDGF-----DLDPD 284
                      |.....:|.:...|...|: |:.....||.|...|     :.||:
Mouse   249 VFRHGTDKNGFSLGFSKNMRQVFGDEKKY-WLLPVFSSQGDGCSFPTCLVNQDPE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 18/67 (27%)
Zdhhc2NP_848482.1 DHHC 126..247 CDD:366691 39/149 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..366 2/7 (29%)
Mediates localization to plasma membrane and recycling endosomes. /evidence=ECO:0000269|PubMed:21471008 298..366 2/5 (40%)
Non-canonical dileucine endocytic signal. /evidence=ECO:0000269|PubMed:28768144 334..335
NPxY-like endocytic signal. /evidence=ECO:0000269|PubMed:28768144 357..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.