DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and Zdhhc16

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_006231465.1 Gene:Zdhhc16 / 654495 RGDID:1591893 Length:377 Species:Rattus norvegicus


Alignment Length:312 Identity:76/312 - (24%)
Similarity:110/312 - (35%) Gaps:100/312 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LCGLPAIYYVLMEIILPELS-----DYWSPGYVFQLLLGLFLFSNVMSNYVMCILVDPSIDPKLM 83
            ||.||.|   |....:|.|.     .:|:      |:|.:|       :|...|...|...|: .
  Rat   100 LCVLPLI---LRTYSVPRLCWHFFYSHWN------LILIVF-------HYYQAITTPPGYPPQ-G 147

  Fly    84 KNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIY 148
            :|.:....      .|.||....|.|:.||..|..|||..||||.:...|:||.|:||||.|..:
  Rat   148 RNDIATVS------ICKKCIYPKPARTHHCSICNRCVLKMDHHCPWLNNCVGHYNHRYFFSFCFF 206

  Fly   149 FFLSCMISLTSSSIFIYVLHGGRYQLFMLTHPA---------------PNSAYFN------SLII 192
            ..|.|          :|..:|. :.||...:.|               .|..|..      |...
  Rat   207 MTLGC----------VYCSYGS-WDLFREAYAAIEKMKQLDKNKLQAIANQTYHQTPPPTFSFRE 260

  Fly   193 RIIYFKLPDIYELVFTLVFVL----LWIGVCVATYVAYDQWSRGYFCYDFELQNIPFDRKLRR-- 251
            ||.:..|..::.|..::...|    :|..|.:         |||....:..:     ::|.||  
  Rat   261 RITHKSLVYLWFLCSSVALALGALTMWHAVLI---------SRGETSIERHI-----NKKERRRL 311

  Fly   252 -----------------NFKTFLGRRMKWTWISGFV--PSQLDH-DGFDLDP 283
                             |:|.|||......|::..:  .|.|.| :|...||
  Rat   312 QAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWDP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 18/45 (40%)
Zdhhc16XP_006231465.1 DHHC 156..305 CDD:396215 44/173 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.