DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and zdhhc12b

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_021327289.1 Gene:zdhhc12b / 569129 ZFINID:ZDB-GENE-070705-356 Length:270 Species:Danio rerio


Alignment Length:275 Identity:62/275 - (22%)
Similarity:104/275 - (37%) Gaps:84/275 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LPAIY--YVLMEIILPELSDYWSPGYV------FQLLLGLFLFSNVMSNYVMCILVDPSID--PK 81
            ||.::  .||:.::|........||:|      .|..||               :.:.:.|  |:
Zfish    45 LPVLFVLLVLVSVLLYFAVSLMDPGFVLTDDCDLQFTLG---------------IAEETQDMIPQ 94

  Fly    82 LMKNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFL 146
            ..|:..:|        .|..|.:..|.||:||:.|..||...||||.:...|:|..|:|   :|:
Zfish    95 TTKSIRLR--------RCGHCLVQQPMRSKHCQTCQHCVRRYDHHCPWIENCVGERNHR---WFV 148

  Fly   147 IYFFLSCMISLTSSSIFIYVL-----HGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDIYELV 206
            :|..:..::.|..    :|:.     |...:|.::.|    |.....:..:..|         |.
Zfish   149 LYLAVQLVVLLWG----LYMAWSGFSHASTWQQWLRT----NGVLLGAAAVVAI---------LA 196

  Fly   207 FTLVFVLLWIG-----VCVATYVAYDQWSRGYFCYDFELQNI-----PFDRKLRRNFKTFLGRRM 261
            .|   |||.:|     |.:.| ..::..||....|   |::.     |||:.:.||.        
Zfish   197 LT---VLLLLGSHLYLVSLNT-TTWEFMSRHRISY---LKHCGADENPFDKGILRNL-------- 246

  Fly   262 KWTWISGFVPSQLDH 276
             |.:...:.|...:|
Zfish   247 -WGFFCAWEPVVWEH 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 16/45 (36%)
zdhhc12bXP_021327289.1 zf-DHHC 97..>171 CDD:307600 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.