DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and zdhhc20a

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_005172729.1 Gene:zdhhc20a / 561776 ZFINID:ZDB-GENE-070424-38 Length:369 Species:Danio rerio


Alignment Length:182 Identity:51/182 - (28%)
Similarity:71/182 - (39%) Gaps:34/182 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 CDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCM-ISLTSSSI 162
            ||:|.::.|.|..||..|..|||..||||.:...|:|..||::|..||.|..|.|: |:.|....
Zfish   125 CDRCQLIKPDRCHHCSTCDKCVLKMDHHCPWVNNCVGFSNYKFFVLFLAYSMLYCVYIAATVLQY 189

  Fly   163 FI--YVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDIYEL--VFTLVFVLLWIGVCVATY 223
            ||  :.|...|    .:.|...|              :|||.:..  |..|.||.....:.:.:.
Zfish   190 FIKFWTLCRRR----AIEHCPEN--------------QLPDTHAKFHVLFLFFVAAMFFISILSL 236

  Fly   224 VAYDQWSRGYFCYDFELQNIP----------FDRKLRRNFKTFLGRRMKWTW 265
            .:|..|..|......|....|          |....|:|.....|.:.|: |
Zfish   237 FSYHLWLVGKNRTTIEAFRAPVFRNGPDKNGFTLGFRKNITQVFGDQKKY-W 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 17/38 (45%)
zdhhc20aXP_005172729.1 zf-DHHC 12..309 CDD:303066 51/182 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.