DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG18810 and ZDHHC2

DIOPT Version :9

Sequence 1:	NP_652670.2	Gene:	CG18810 / 59171	FlyBaseID:	FBgn0042133	Length:	300	Species:	Drosophila melanogaster
Sequence 2:	XP_011542846.1	Gene:	ZDHHC2 / 51201	HGNCID:	18469	Length:	412	Species:	Homo sapiens

Alignment Length:	135	Identity:	38/135 - (28%)
Similarity:	54/135 - (40%)	Gaps:	33/135 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly    99 CDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCM-ISLTSSSI 162
            ||:|.::.|.|..||..|..|:|..||||.:...|:|..||::|..||.|..|.|: |:.|....
Human   174 CDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLFIAATDLQY 238

  Fly   163 FIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDI---YELVFTLVFVLLWIGVCVATYV 224
            ||.....|                            |||.   :.::| |.|......|.:::..
Human   239 FIKFWTNG----------------------------LPDTQAKFHIMF-LFFAAAMFSVSLSSLF 274

  Fly   225 AYDQW 229
            .|..|
Human   275 GYHCW 279

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG18810	NP_652670.2	zf-DHHC	92..>138	CDD:303066	16/38 (42%)
ZDHHC2	XP_011542846.1	zf-DHHC	172..293	CDD:279823	38/135 (28%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5273
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810