DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and ZDHHC9

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001008223.1 Gene:ZDHHC9 / 51114 HGNCID:18475 Length:364 Species:Homo sapiens


Alignment Length:191 Identity:48/191 - (25%)
Similarity:79/191 - (41%) Gaps:67/191 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FLFLFILCGLPAIY------YVLMEIILPELSDYWSPGY-VFQLLLGLFLFSNVMSNYVMCILVD 75
            :|.||::.|...::      |:.:::         ||.. ||..:  |||||  |:..:.....|
Human    39 YLTLFLILGTCTLFFAFECRYLAVQL---------SPAIPVFAAM--LFLFS--MATLLRTSFSD 90

  Fly    76 PSIDPKLM---------------------------------KNQLVRGQHSEDWHECDKCGILAP 107
            |.:.|:.:                                 .||:|:.::      |..|.|..|
Human    91 PGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKY------CYTCKIFRP 149

  Fly   108 PRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMISLTSSSIFIYVLH 168
            ||:.||..|..||...||||.:.|.|:|..|||||:.|:        :||:..:|:::..:
Human   150 PRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFI--------LSLSLLTIYVFAFN 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 18/45 (40%)
ZDHHC9NP_001008223.1 DHHC 138..261 CDD:396215 27/79 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.