DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and Zdhhc18

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_006539081.1 Gene:Zdhhc18 / 503610 MGIID:3527792 Length:407 Species:Mus musculus


Alignment Length:190 Identity:50/190 - (26%)
Similarity:76/190 - (40%) Gaps:54/190 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LLGLFLFSNVMSNYVMCILVDPSIDPKL-------------------------MKNQLVRGQHSE 94
            ::...||..|||..:.....||.|.|:.                         .:..::.|| :.
Mouse   118 IIAAILFFFVMSCLLQTSFTDPGILPRATICEAAALEKQIDNTGSSTYRPPPRTREVMINGQ-TV 181

  Fly    95 DWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMISLTS 159
            ....|..|.:..|||:.||..|..||...||||.:.|.|:|..|||:|:.|:        :||:.
Mouse   182 KLKYCFTCKMFRPPRTSHCSVCDNCVERFDHHCPWVGNCVGRRNYRFFYAFI--------LSLSF 238

  Fly   160 SSIFIY---VLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLP-DIYELVFTLVFVLLW 215
            .:.||:   |.|        ||..:..|.:.::|      .|.| .:.|||  :.|..:|
Mouse   239 LTAFIFACVVTH--------LTLLSQGSNFLSAL------KKTPASVLELV--ICFFSIW 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 17/45 (38%)
Zdhhc18XP_006539081.1 DHHC 183..306 CDD:366691 39/124 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.