DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and Zdhhc14

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001034432.1 Gene:Zdhhc14 / 499014 RGDID:1565877 Length:489 Species:Rattus norvegicus


Alignment Length:195 Identity:47/195 - (24%)
Similarity:75/195 - (38%) Gaps:61/195 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FLFLFILCGLPAIYYV-----LMEIILPELSDYWSPGYVFQLLLGLFLFSNVMSNYVMCILVDPS 77
            :|.|.::.....:::.     |.|.|.|.:.           ::|..||..||...:.....||.
  Rat    65 YLTLILILVTSGLFFAFDCRYLAEKITPAIP-----------VVGGILFFFVMGTLLRTSFSDPG 118

  Fly    78 IDPKL----------------------------MKNQLVRGQHSEDWHECDKCGILAPPRSRHCR 114
            :.|:.                            .|..::.|| :.....|..|.|..|||:.||.
  Rat   119 VLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVIINGQ-TVKLKYCFTCKIFRPPRASHCS 182

  Fly   115 KCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTH 179
            .|..||...||||.:.|.|:|..|||:|:.|:        :||:..::||:.        |::||
  Rat   183 LCDNCVEQFDHHCPWVGNCVGKRNYRFFYMFI--------LSLSFLTVFIFA--------FVITH 231

  Fly   180  179
              Rat   232  231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 18/45 (40%)
Zdhhc14NP_001034432.1 DHHC 164..287 CDD:396215 30/84 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.