Sequence 1: | NP_652670.2 | Gene: | CG18810 / 59171 | FlyBaseID: | FBgn0042133 | Length: | 300 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001034432.1 | Gene: | Zdhhc14 / 499014 | RGDID: | 1565877 | Length: | 489 | Species: | Rattus norvegicus |
Alignment Length: | 195 | Identity: | 47/195 - (24%) |
---|---|---|---|
Similarity: | 75/195 - (38%) | Gaps: | 61/195 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 FLFLFILCGLPAIYYV-----LMEIILPELSDYWSPGYVFQLLLGLFLFSNVMSNYVMCILVDPS 77
Fly 78 IDPKL----------------------------MKNQLVRGQHSEDWHECDKCGILAPPRSRHCR 114
Fly 115 KCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTH 179
Fly 180 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18810 | NP_652670.2 | zf-DHHC | 92..>138 | CDD:303066 | 18/45 (40%) |
Zdhhc14 | NP_001034432.1 | DHHC | 164..287 | CDD:396215 | 30/84 (36%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |