DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and CG5196

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster


Alignment Length:271 Identity:74/271 - (27%)
Similarity:101/271 - (37%) Gaps:74/271 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SDYWSP-----GYVFQLLLGLFLFSNVMS--NYVMCILVDPSIDPKLMKNQLVRGQHSEDWHE-- 98
            |.:|.|     |:..|   .|||..:.::  ||||..|..|.:.||             .||.  
  Fly    35 SMWWPPNKSFAGFAHQ---ALFLLLSTLATFNYVMATLTGPGLMPK-------------QWHPKD 83

  Fly    99 ---------CDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCM 154
                     |.||.....|||.|||||..||...||||.:...|:|..|:.||.|||::..|.  
  Fly    84 PKDAQFLQYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILG-- 146

  Fly   155 ISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRII--------------------YFKL 199
             ||..:.:.......|.|:.:.|||...:.|.....::.||                    :.:|
  Fly   147 -SLQGTVVLCCSFWRGIYRYYYLTHGLAHLASVQFTLLSIIMCILGMGLAIGVVIGLSMLLFIQL 210

  Fly   200 PDIYELVFTLVFVLLWIGVCVATYVAYDQWSRGYFCYDFELQNIPFDRKLRRNFKTFL------- 257
            ..|   |.....:.:|| |..|.|..|    |...|.|..|  .|:|...|.|.:...       
  Fly   211 KTI---VNNQTGIEIWI-VEKAIYRRY----RNADCDDEFL--YPYDLGWRANLRLVFNDECQKR 265

  Fly   258 GRRMKWTWISG 268
            |..::|..:.|
  Fly   266 GDGIEWPVVEG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 21/56 (38%)
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 39/139 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467524
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.