DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and app

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster


Alignment Length:277 Identity:62/277 - (22%)
Similarity:102/277 - (36%) Gaps:91/277 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FLFLFILCGLPAIYYVLMEIILPELSDYWSPGYVFQLLLGLFLFSNVMSNYVMCILVDPSIDPKL 82
            :|...::.|..|:::.   ...|.|:|..:|...   ::|..|:...||:.:.....||.:.|:.
  Fly    47 YLTCILITGTSALFFA---FDCPFLADSINPAIP---IVGAVLYFFTMSSLLRTTFTDPGVIPRA 105

  Fly    83 ----------------------------MKNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVC 119
                                        .|..||:|| :.....|..|.|..|||:.||..|..|
  Fly   106 SNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQ-TVKLKYCFTCKIFRPPRASHCSLCDNC 169

  Fly   120 VLMRDHHCFFTGCCIGHENYRYFFYFLI------YFFLSCMISLTSSSIFIYVLHGGRYQLFMLT 178
            |...||||.:.|.|:|..|||:|:.||:      .|..||.::      .:.:|....:::|.:.
  Fly   170 VDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVT------HLVLLMKKEHEVFNVI 228

  Fly   179 HPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVFVLLWIGVCVATYVAY----DQ----------- 228
            ..||    |..:::.|.:|.               :|..:.:|.:..|    ||           
  Fly   229 KAAP----FTVIVVFICFFS---------------IWSVIGLAGFHTYLTTSDQTTNEDLKGSFS 274

  Fly   229 ----------WSRGYFC 235
                      :|||..|
  Fly   275 SKGGPRTQNPYSRGNIC 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 18/45 (40%)
appNP_648561.2 zf-DHHC 146..270 CDD:279823 39/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467552
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.