DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and Zdhhc12

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001013257.1 Gene:Zdhhc12 / 366014 RGDID:1306593 Length:267 Species:Rattus norvegicus


Alignment Length:237 Identity:60/237 - (25%)
Similarity:91/237 - (38%) Gaps:30/237 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ELSDYWSPGYVFQLLLGLFLFSNVMSNYVMCILVDPSI---------DPKLMKNQLVRGQHSEDW 96
            ||..:...|.:|..|..|.|....:..|:...|:||..         :||  :.|......:...
  Rat    34 ELRQWEEQGELFLPLTFLLLVLGSLLLYLAVSLMDPGYVTAQPQPQEEPK--EEQTAMVPQAIPL 96

  Fly    97 HECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMISLTSSS 161
            ..|..|.:|.|.|:||||:|..||...||||.:...|:|..|:.   .|:.|..|..::.|..  
  Rat    97 RRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHP---LFVAYLALQLVVLLWG-- 156

  Fly   162 IFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVFVLLWIGVCVATYVAY 226
              :|:...| .|.|.     |...:..|..:....|.|...:.||.:|: :...:.:.......:
  Rat   157 --LYLAWSG-LQFFQ-----PWGLWLRSTGLLFTTFLLLSFFALVVSLL-LASHLYLVARNTTTW 212

  Fly   227 DQWSRGYFCYDFELQNIPFDRKLRRNFKTFLGRRMKWTWISG 268
            :..|.....|..:..:.||||...||...|.     ..|.||
  Rat   213 EFISSHRIAYLRQRTSNPFDRGPTRNLAHFF-----CGWPSG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 18/45 (40%)
Zdhhc12NP_001013257.1 DHHC <123..217 CDD:396215 22/107 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.