DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and Zdhhc6

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001032741.1 Gene:Zdhhc6 / 361771 RGDID:1304657 Length:413 Species:Rattus norvegicus


Alignment Length:270 Identity:69/270 - (25%)
Similarity:105/270 - (38%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YW----SPGYV-FQLLLGLFLFSNVMSNYVMCILVDPSIDPKLMKNQLVRGQHSEDWHECDKCGI 104
            ||    :.|.| |.:|:...:.  ::.||...:...|...|:..|.:  ..|.|.....|..|..
  Rat    46 YWPLHTTGGSVNFIMLINWTVM--ILYNYFNAMFAGPGFVPRGWKPE--NPQDSMYLQYCKVCQA 106

  Fly   105 LAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMISLTSSSIFIYVLHG 169
            ...|||.|||||..||:..||||.:...|.||:|:..|..||:...|.|     :.:.||:|:  
  Rat   107 YKAPRSHHCRKCNRCVMKMDHHCPWINNCCGHQNHASFTLFLLLAPLGC-----THAAFIFVM-- 164

  Fly   170 GRY-QLFMLTHPAPNSAYFNSLIIR-----IIYFKLPDIYELVFTLVFVL-----------LWIG 217
            ..| ||:.......|:...:....|     |:.|.|......:|.|...|           :.|.
  Rat   165 TMYTQLYNRLSFGWNTVKIDMSAARRDPPPIVPFGLAAFAATLFALGLALGTTIAVGMLFFIQIK 229

  Fly   218 VCVATYVAYDQWSR-------GYFCYDFELQNIPFDRKLRRNFKTFLGRRMK-----WTWISGFV 270
            :.:....:.:.|..       .|:..| |:...|:|          :|.:.|     :|| || |
  Rat   230 IILRNKTSIESWIEEKAKDRIQYYQLD-EVFVFPYD----------MGSKWKNLKQVFTW-SG-V 281

  Fly   271 PSQLDHDGFD 280
            |   :.||.:
  Rat   282 P---EGDGLE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 20/45 (44%)
Zdhhc6NP_001032741.1 DHHC 95..241 CDD:396215 41/152 (27%)
SH3_2 317..394 CDD:400139
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.