DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and CG1407

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster


Alignment Length:204 Identity:52/204 - (25%)
Similarity:82/204 - (40%) Gaps:59/204 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 CDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCM-ISLTSSSI 162
            |:||.|:.|.|:.||..|..|||..||||.:...|:...||:||..||.|..:.|: ::.||...
  Fly   131 CEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHD 195

  Fly   163 FIYVLHGGRY---------QLFMLTHPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVFVLLWIGV 218
            |:.....|.|         ||        |::......|..::|     ..::|.:..|.|:   
  Fly   196 FVEFWKVGAYDNNGYSAQGQL--------NASGMGRFHILFLFF-----IAIMFAISLVSLF--- 244

  Fly   219 CVATYVAYDQWSRGYFCYDFELQNIPFDRKLRRNFKTFLGRRMKWTWISGFVPSQLDHDGFDLDP 283
                         ||..|     .:..:|....:|:..:.|      :.|  |   |.:|::|. 
  Fly   245 -------------GYHIY-----LVLVNRTTLESFRAPIFR------VGG--P---DKNGYNLG- 279

  Fly   284 DNERVADWC 292
               |.|::|
  Fly   280 ---RYANFC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 17/38 (45%)
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 42/161 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467496
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.