DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and zdhhc8b

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_840089.2 Gene:zdhhc8b / 352941 ZFINID:ZDB-GENE-030407-3 Length:751 Species:Danio rerio


Alignment Length:210 Identity:65/210 - (30%)
Similarity:93/210 - (44%) Gaps:41/210 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ILCGLPAIYYVLMEIILPELSDYWSPGYVFQLLLGL-FLFSNVMSNYVMCILVDPSIDPK----- 81
            :|.|...:::|   ...|.|:...||  |..|..|: |||  |::|:.|...:||.:.|:     
Zfish    23 LLVGSTTLFFV---FTCPWLTKAVSP--VVPLYNGIVFLF--VLANFSMATFMDPGVFPRADEDE 80

  Fly    82 ---------LMKNQLVRG-QHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGH 136
                     |.||..::| |....|  |..|....|||..||..|..||...||||.:...|||.
Zfish    81 DKDDDFRAPLYKNVEIKGIQVRMKW--CATCHFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGR 143

  Fly   137 ENYRYFFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRII----YF 197
            .||||||.||:      .:|:....:|.:.|      ||||.|....||...::.:.::    .|
Zfish   144 RNYRYFFLFLL------SLSVHMVGVFSFGL------LFMLHHLETLSALHTTVTLVVMCVTGLF 196

  Fly   198 KLPDIYELVFTLVFV 212
            .:|.:....|.:|.|
Zfish   197 FIPVMGLTGFHMVLV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 18/45 (40%)
zdhhc8bNP_840089.2 zf-DHHC 99..224 CDD:279823 42/127 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..346
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 437..461
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 633..659
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 666..685
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 703..736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.