DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and Dnz1

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster


Alignment Length:229 Identity:60/229 - (26%)
Similarity:90/229 - (39%) Gaps:50/229 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGLPAI-----------YYVLMEIILPEL-SDYWSPGYVFQLLLGLFLFSNVMSNYVMCILVDPS 77
            ||:..:           |.|:..|||..: ...|...:|  :|....:|...|| :...:..||.
  Fly     8 CGIACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHV--VLFNTVVFLLAMS-HSKAVFSDPG 69

  Fly    78 IDP------------KLMKNQLVRGQ-HSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFF 129
            ..|            ...||....|. ||.:|..|.:|....|||:.|||.|..|:...||||.:
  Fly    70 TVPLPANRLDFSDLHTTNKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPW 134

  Fly   130 TGCCIGHENYRYFFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRI 194
            ...|:|..|.:||..||||.   .::||.|.::.:     |.:     ..|....:.      .:
  Fly   135 INNCVGERNQKYFLQFLIYV---ALLSLYSIALIV-----GSW-----VWPCEECSQ------NV 180

  Fly   195 IYFKLPDIYELVFTLVFVLLWIGVCVATYVAYDQ 228
            |..:|..|:.::..||..|..:.|   |.:..||
  Fly   181 IETQLRMIHSVILMLVSALFGLFV---TAIMVDQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 19/45 (42%)
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 41/137 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467590
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.