DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and GABPI

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster


Alignment Length:188 Identity:46/188 - (24%)
Similarity:83/188 - (44%) Gaps:39/188 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIY 148
            ::.|:.||.    :.|:.|..:.|.|:.||..||.||..||||.::..||||..||.::      
  Fly   257 RSGLMHGQP----NICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWY------ 311

  Fly   149 FFLSCMISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFK--LPDIYELVFT--- 208
                 ::.|..|.|.:  |.|....|..:.||        .:::|.:.:.  |||....||.   
  Fly   312 -----IVGLALSEIAL--LLGANLTLTSICHP--------FMVVRPLGYPVLLPDDCSEVFEGFD 361

  Fly   209 --LVFVLLWIGVCVATYVAY------DQWSRGYFCYDFE-LQNIPFDRKLRRNFKTFL 257
              :.||:....:.:::|:|:      ..|.:|...:::: ..|.....::..|::..|
  Fly   362 LGISFVVACYALLISSYIAFILARQAYLWWKGSTLHEYKRTSNAAGRNRIWSNWRAIL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 18/45 (40%)
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 42/161 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467587
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.