DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and CG17075

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster


Alignment Length:236 Identity:56/236 - (23%)
Similarity:90/236 - (38%) Gaps:75/236 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PKEKLEQFLFLFILCGLPAIYYVLMEIILPELSDYWSPGYVFQLLLGLFLFSNVMSNYVMCILVD 75
            |...|:.|.:|.:|....|.|:||:......:.     |.::.|:.||:|..  :::::..:|.|
  Fly   109 PLHPLQIFGWLVLLLFGVASYWVLIPAFHARIQ-----GPLYGLITGLYLVH--IASHLTALLTD 166

  Fly    76 PSIDPKLMK----NQLV----RGQHSE--DWHECDKCGI-LAPPRSRHCRKCGVCVLMRDHHCFF 129
            |: |.:|.:    :::|    |.:||.  :...|..|.| .:..|::||..|..||...||||.:
  Fly   167 PA-DKELRRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKW 230

  Fly   130 TGCCIGHENYRYFFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRI 194
            ...|||..||        ..||.|::|                                      
  Fly   231 LNHCIGSRNY--------VAFLMCVVS-------------------------------------- 249

  Fly   195 IYFKLPDIYELVFTLVFVLLWIGVCVATYVAYDQWSRGYFC 235
                     .:|.|||.|...:...|..|:..| |...|:|
  Fly   250 ---------AVVATLVIVAAVVAQIVFYYIQPD-WLSFYWC 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 18/48 (38%)
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 33/138 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.