Sequence 1: | NP_652670.2 | Gene: | CG18810 / 59171 | FlyBaseID: | FBgn0042133 | Length: | 300 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_766142.2 | Gene: | Zdhhc17 / 320150 | MGIID: | 2445110 | Length: | 632 | Species: | Mus musculus |
Alignment Length: | 230 | Identity: | 52/230 - (22%) |
---|---|---|---|
Similarity: | 81/230 - (35%) | Gaps: | 78/230 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 CDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYF---FYFLI------------Y 148
Fly 149 FFLSCMISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVFVL 213
Fly 214 LWIGVCVATYVAYDQWSRGYFCYDFELQNIPFDRKLRRNFKTFLGRRMKWTWISGFVPSQLDH-- 276
Fly 277 -----DGFDLDPDNER--------VADWCSETTIK 298 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18810 | NP_652670.2 | zf-DHHC | 92..>138 | CDD:303066 | 17/38 (45%) |
Zdhhc17 | NP_766142.2 | Necessary and sufficient for interaction with DNAJC5 and SNAP25. /evidence=ECO:0000269|PubMed:25253725 | 11..305 | ||
ANK repeat | 89..120 | CDD:293786 | |||
PHA03095 | 100..>352 | CDD:222980 | |||
ANK repeat | 122..154 | CDD:293786 | |||
ANK repeat | 156..187 | CDD:293786 | |||
Ank_2 | 161..255 | CDD:372319 | |||
ANK repeat | 189..221 | CDD:293786 | |||
ANK repeat | 224..255 | CDD:293786 | |||
DHHC | 438..568 | CDD:366691 | 39/167 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |