DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and Zdhhc8

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster


Alignment Length:261 Identity:76/261 - (29%)
Similarity:100/261 - (38%) Gaps:74/261 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WPKEKLEQFLFLFILCGLPAIYYVLMEIILPELSDYWSPGYVFQLLLGLFLFSNVMSNYVMCILV 74
            |....|..|||.|    .|..:||        .|..|...|     .|:..|. |::|:.:...:
  Fly    17 WIVLLLTTFLFFF----YPCQFYV--------KSHPWVLAY-----QGVITFF-VLANFTLATFM 63

  Fly    75 DPSIDPK--------------LMKNQLVRG-QHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRD 124
            ||.|.||              |.||..:.| .....|  |..|....|||..||..|..|:...|
  Fly    64 DPGIIPKASPDEDCEEELRAPLYKNAEINGITVKMKW--CVTCKFYRPPRCSHCSVCNHCIETFD 126

  Fly   125 HHCFFTGCCIGHENYRYFFYFLIYFFLSCMISLTSSSIF----IYVLHGGRYQLFM--LTHPAPN 183
            |||.:...|||..|||:||:||:      .:|:...|||    :|||.      .|  :...|| 
  Fly   127 HHCPWVNNCIGRRNYRFFFFFLV------SLSIHMLSIFSLCLVYVLK------IMPNIKDTAP- 178

  Fly   184 SAYFNSLIIRIIYFKLPDIYEL-VFTLV---FVLLWIGVCVATYV------AYDQWSRGYF---C 235
                   |:.||...|..|..: :|.|.   .||:..|......|      .|:.:|||.:   |
  Fly   179 -------IVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCWHNCC 236

  Fly   236 Y 236
            |
  Fly   237 Y 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 17/45 (38%)
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 45/146 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.