DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and Zdhhc1

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_008770707.1 Gene:Zdhhc1 / 291967 RGDID:1589775 Length:502 Species:Rattus norvegicus


Alignment Length:279 Identity:65/279 - (23%)
Similarity:112/279 - (40%) Gaps:67/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RSLKN--IWPKEKLEQFLFLFILCGLPAIYYVLM--EIILPELSDYWSP-GYVFQLLLGLFLFSN 63
            ||.:|  .||...|:      |:..|..:::.::  .:::|.|..:|.| ||.   .:|. :|:.
  Rat    35 RSRRNGWSWPPHPLQ------IVAWLLYLFFAVIGFGVLVPLLPHHWVPAGYA---CMGA-IFAG 89

  Fly    64 VMSNYVMCILVDP---SIDPKLMKNQLV---RGQHS---EDWHECDKCGILAPPRSRHCRKCGVC 119
            .:..::..:.:||   ::..|.....|.   |.||:   ||.| |:.|.:....||:||..|..|
  Rat    90 HLVVHLTAVSIDPADANVRDKSYSGPLPIFNRSQHAHVIEDLH-CNLCDVDVSARSKHCSACNKC 153

  Fly   120 VLMRDHHCFFTGCCIGHENYRYFF------------------YFLIYFFLSCMISLTSSSIFIYV 166
            |...||||.:...|:|..|||.|.                  |..:.||::.|...|:....:..
  Rat   154 VCGFDHHCKWLNNCVGERNYRLFLHSVASALLGVLLLVLVATYVFVEFFVNPMRLRTNQHFEVLK 218

  Fly   167 LHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVFV------LLWIGVCVATYVA 225
            .|...:.:|:...|....|              |.|..|...|:.:      ||...:|...|:.
  Rat   219 NHTDVWFVFLPAAPVETQA--------------PAILALAALLILLGLLSTALLGHLLCFHIYLM 269

  Fly   226 YDQWSRGYFCYDFELQNIP 244
            :.:.:    .|::.:|:.|
  Rat   270 WHKLT----TYEYIVQHRP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 19/48 (40%)
Zdhhc1XP_008770707.1 DHHC 126..281 CDD:396215 40/173 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.