DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001034348.1 Gene:Zdhhc19 / 288045 RGDID:1309014 Length:359 Species:Rattus norvegicus


Alignment Length:234 Identity:63/234 - (26%)
Similarity:92/234 - (39%) Gaps:75/234 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YVFQLLLG-LFL---FSNVMSNYVMCILVDPSIDPKLMKNQLVRGQHSED--------------- 95
            :||..:.| ||:   ||.|..|:     .||.|        |.||..|||               
  Rat    62 WVFPAVTGPLFILTFFSLVSLNF-----SDPGI--------LHRGSVSEDPRTVHVVRVNQRAFR 113

  Fly    96 --WHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFL------- 151
              |  |.||....|||:.||..|.:||...||||.:...||||.|:|.|...:::..|       
  Rat   114 LEW--CPKCLFHRPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRLFVLLILFLCLYSGALLV 176

  Fly   152 SCMISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVFVLLWI 216
            :|::.|..:|...:.|  .:....::..||..             |.:|         :|:|:.|
  Rat   177 TCLMFLIHTSHLPFSL--DKAMAILVAVPAAG-------------FLIP---------LFLLMLI 217

  Fly   217 GVCVATYVAYDQWSRGY--FCYDFELQNIPFDRKLRRNF 253
            ..     ::..:..|.|  .|.|.|..| |||:...:|:
  Rat   218 QA-----LSVSRAERSYESKCRDHEEYN-PFDQGFAKNW 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 23/62 (37%)
Zdhhc19NP_001034348.1 zf-DHHC 112..230 CDD:279823 36/148 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.