DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and erf2

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_595766.1 Gene:erf2 / 2541058 PomBaseID:SPBC3H7.09 Length:350 Species:Schizosaccharomyces pombe


Alignment Length:299 Identity:71/299 - (23%)
Similarity:101/299 - (33%) Gaps:94/299 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LFILCG-------LPAIYYVLMEIILPEL-----SDYW-----SPGYVFQLLLGLFLFSNVMSNY 68
            :::.||       ..|....|..:|||.:     |.:|     ||......   .:|::..:.:.
pombe    71 IYLCCGRLQMSSQYKAFLISLFALILPGVLFFIFSAFWLWHHVSPAVPITF---AYLYALAVVSM 132

  Fly    69 VMCILVDPSIDPK----LMKNQ-------------LVRGQHSE----DWHECDKCGILAPPRSRH 112
            ..|...||.|.|:    |..|.             ||....|:    :...|..|.:..|||:.|
pombe   133 FKCSTADPGILPRNAYSLTYNPAHPWSVIPEDRKVLVGSTRSDSVFVNTVYCHTCHLYRPPRASH 197

  Fly   113 CRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFML 177
            |..|..||...||||.:...|||..||||:|.||:...||.          :|:...|.|.....
pombe   198 CHLCDNCVEYLDHHCIWLNTCIGRRNYRYYFIFLLSVVLSA----------LYLTGLGFYTSIGS 252

  Fly   178 THPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVFVLLWIGVC--VATYVAYDQWSRG-YFCYDFE 239
            .|.:.::.:       ..:.:.|              |.||.  :..|.|......| .|||...
pombe   253 FHESTDTNF-------AAHLRRP--------------WAGVSFFLGIYGALGAILPGILFCYQCY 296

  Fly   240 L----QNI---------------PFDRKLRRNFKTFLGR 259
            |    ||:               ||...:..||...|.|
pombe   297 LISVGQNVHEYLRAKSTETEDVHPFHDSIWLNFLVVLCR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 18/49 (37%)
erf2NP_595766.1 COG5273 57..350 CDD:227598 71/299 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.