DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and ZDHHC20

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001316988.1 Gene:ZDHHC20 / 253832 HGNCID:20749 Length:365 Species:Homo sapiens


Alignment Length:283 Identity:63/283 - (22%)
Similarity:96/283 - (33%) Gaps:76/283 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 FQLLLGLFLFSNVMSNYVMCILVDPSIDPK---LMKNQLVRGQH--------------------- 92
            |.|...:|::|     |.|.|...|:...|   |..::..|.:.                     
Human    58 FHLFFVMFVWS-----YWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIY 117

  Fly    93 ----SEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSC 153
                |:....|:||.::.|.|:.||..|..|:|..||||.:...|:|..||::|..||:|..|.|
Human   118 TTSASKTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYC 182

  Fly   154 M-ISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVFVLLWIG 217
            : ::.|....||         .|.........|.|:                 |..|.||.....
Human   183 LFVAATVLEYFI---------KFWTNELTDTRAKFH-----------------VLFLFFVSAMFF 221

  Fly   218 VCVATYVAYDQWSRGYFCYDFELQNIP----------FDRKLRRNFKTFLGRRMKWTWISGFVPS 272
            :.|.:..:|..|..|......|....|          |.....:|::...|...|: |:.....|
Human   222 ISVLSLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKY-WLLPIFSS 285

  Fly   273 QLDHDGF-----DLDPDNERVAD 290
            ..|...|     .:||:...|.:
Human   286 LGDGCSFPTRLVGMDPEQASVTN 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 17/70 (24%)
ZDHHC20NP_001316988.1 zf-DHHC 16..301 CDD:327686 60/274 (22%)
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 140..143 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.