DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and Zdhhc2

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_659564.3 Gene:Zdhhc2 / 246326 RGDID:628681 Length:366 Species:Rattus norvegicus


Alignment Length:315 Identity:70/315 - (22%)
Similarity:100/315 - (31%) Gaps:105/315 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YWSPGYVFQLLLGLFLFSNV-------MSN---YVMCIL---------------------VDPSI 78
            ||.|.....||||...::..       |.|   .|:|::                     ::||.
  Rat    18 YWIPVVFISLLLGWSYYAYAIQLCIVSMENIGEQVVCLMAYHLLFAMFVWSYWKTIFTLPMNPSK 82

  Fly    79 DPKLM---KNQLVRGQHSEDWHE----------------------CDKCGILAPPRSRHCRKCGV 118
            :..|.   |..|.|....|...|                      ||:|.::.|.|..||..|..
  Rat    83 EFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCRLIKPDRCHHCSVCDK 147

  Fly   119 CVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCM-ISLTSSSIFIYVLHGGRYQLFMLTHPAP 182
            |:|..||||.:...|:|..||::|..||.|..|.|: |:.|....||.....|            
  Rat   148 CILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLFIAATDLQYFIRFWTNG------------ 200

  Fly   183 NSAYFNSLIIRIIYFKLPDI---YELVFTLVFVLLWIGVCVATYVAYDQWSRGYFCYDFELQNIP 244
                            |||.   :.::| |.|......|.:::...|..|.........|....|
  Rat   201 ----------------LPDTQAKFHIMF-LFFAAAMFSVSLSSLFGYHCWLVSKNKSTLEAFRNP 248

  Fly   245 ----------FDRKLRRNFKTFLGRRMKWTWISGFVPSQLDHDGF-----DLDPD 284
                      |.....:|.:...|...|: |:.....||.|...|     :.||:
  Rat   249 VFRHGTDKNGFSLGFSKNMRQVFGDEKKY-WLLPIFSSQGDGCSFPTCLVNQDPE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 18/67 (27%)
Zdhhc2NP_659564.3 DHHC 19..301 CDD:418707 67/311 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..366 2/6 (33%)
Mediates localization to plasma membrane and recycling endosomes. /evidence=ECO:0000250|UniProtKB:P59267 298..366 2/5 (40%)
Non-canonical dileucine endocytic signal. /evidence=ECO:0000250|UniProtKB:P59267 334..335
NPxY-like endocytic signal. /evidence=ECO:0000250|UniProtKB:P59267 357..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.