DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_955013.1 Gene:Zdhhc19 / 245308 MGIID:2682948 Length:347 Species:Mus musculus


Alignment Length:294 Identity:70/294 - (23%)
Similarity:97/294 - (32%) Gaps:117/294 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LPELSDYWSPGYVF-----QLLL---GLF---------------------------LFSNVMSNY 68
            ||.:...|.|..||     .|||   |||                           .||.|..|:
Mouse    17 LPSIPLSWFPSSVFAAFNVTLLLFLSGLFFGFPCRWLVQNGEWAFPAITGPLFILTFFSLVSLNF 81

  Fly    69 VMCILVDPSIDPKLMKNQLVRGQHSED-----------------WHECDKCGILAPPRSRHCRKC 116
                 .||.|        |.||...||                 |  |.||....|||:.||..|
Mouse    82 -----SDPGI--------LHRGSTKEDPMTVHVVRVNQRAFRLEW--CPKCLFHRPPRTYHCPWC 131

  Fly   117 GVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFL-------SCMISLTSSSIFIYVLHGGRYQL 174
            .:||...||||.:...||||.|:|.|...::...|       :|:..|..:....:.|..|  ..
Mouse   132 NICVEDFDHHCKWVNNCIGHRNFRLFMLLVLSLCLYSGALLVTCLTFLFRTRHLPFSLDKG--MA 194

  Fly   175 FMLTHPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVFVLLWIGVCVATYV--AYDQWSRGYFCYD 237
            .::..||..             |.:|         :|:||.|.....:..  :|:...|.:..|:
Mouse   195 ILVAVPAAG-------------FLIP---------LFLLLLIQALSVSRAESSYESKCRYHPEYN 237

  Fly   238 FELQNIPFDRKLRRNFKTFLGRRMKWTWISGFVP 271
                  |||:...:|          | :::.|.|
Mouse   238 ------PFDQGFAKN----------W-YLAMFAP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 22/62 (35%)
Zdhhc19NP_955013.1 DHHC 109..>181 CDD:366691 26/73 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..347
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.