DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and dhhc-9

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001362080.1 Gene:dhhc-9 / 183426 WormBaseID:WBGene00016620 Length:313 Species:Caenorhabditis elegans


Alignment Length:298 Identity:69/298 - (23%)
Similarity:121/298 - (40%) Gaps:51/298 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KLEQFLFLFILCGLPAIYYVLMEIILPELSDYWSPGYVFQLL--LGLFLFSNVMSNYVMCILVDP 76
            ::.:||..|:......:.:....||:| ....:.|.::..||  .||:...|:..:|.....:.|
 Worm    37 QIGKFLVFFVYFISTFLAFTSFFIIIP-YEQLYKPAWLLLLLGTCGLYFLFNIQYHYYKARTIPP 100

  Fly    77 SIDPKLMKNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRY 141
            ..:|         |:..:.:  |.||.......:.||..|..|||..||||.:...|:|..|:|:
 Worm   101 VANP---------GEEGDSF--CSKCNYWKSDNAHHCSVCEKCVLGMDHHCIWINQCVGLHNHRH 154

  Fly   142 FFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFM--LTHPAPNSAYFNSLIIRIIYFKLPDI-- 202
            ||.|:      ..::|.:::|.|     ..||.|.  |...:..:.|..::   :.:..|.||  
 Worm   155 FFLFI------ANLTLAAATIII-----AGYQSFSDHLFLESSQTTYCTTI---LEHAPLQDIIC 205

  Fly   203 -YE--LVFTLVFVLLWIGVCVATYVAYDQW-----SRGYFCYDF-----ELQNIPFDRKLRRNFK 254
             |:  ...::||..|..|:.:........|     |.|....|:     ..:|....::|.:.||
 Worm   206 DYDGFARTSVVFCYLLSGILLVMVGGLTSWNIYLISIGCTYIDYLKLTGSKKNTSARKRLNKGFK 270

  Fly   255 ----TFLGRRMKWTWISGFV-PSQLDHDGF-DLDPDNE 286
                .|||.|...|:....: |:.|....: |:.|.::
 Worm   271 ANWRNFLGLRRNRTFFKCVIMPTALPPVKYEDISPKSD 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 15/45 (33%)
dhhc-9NP_001362080.1 DHHC 106..251 CDD:366691 40/160 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165801
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.