DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and dhhc-14

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001024514.2 Gene:dhhc-14 / 181109 WormBaseID:WBGene00044071 Length:565 Species:Caenorhabditis elegans


Alignment Length:215 Identity:56/215 - (26%)
Similarity:89/215 - (41%) Gaps:45/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LMEIILPELS----DYWSPGYVFQLLLGLFLFSNVMSNYVMCILVDPSI------DPKLMKNQLV 88
            :.|.||..||    .:|...:..|:|..|.:.:...:.:.:..| ||.:      ..:|..|:..
 Worm   328 IAEAILMVLSWSAYAHWYVPWWAQMLFVLSVLALAFTLFRIGTL-DPGVVRAAKNCHQLFVNEAE 391

  Fly    89 RG-QHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLS 152
            .| ||.:.:  |..|.|.....::||..||.||...||||.:...|:...|.|.|..|:|     
 Worm   392 AGIQHQQKY--CFTCFIRKMDHTKHCAVCGFCVNNFDHHCPWLNSCVTRRNMREFIMFVI----- 449

  Fly   153 CMISLTSSSIFIYVLHGGRYQLFM-----LTHPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVFV 212
             .:|::|:   ||.:....|.|..     |.......|:   |:|.||   |..::.|:..::| 
 Worm   450 -SVSVSSA---IYCMATSHYALLQIEDHGLEEFLETDAF---LMITII---LSAMHALMLAVLF- 503

  Fly   213 LLWIGVCVATYVAYDQWSRG 232
                  |    |..:|.|:|
 Worm   504 ------C----VQMNQISQG 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 15/45 (33%)
dhhc-14NP_001024514.2 ANK 19..143 CDD:238125
Ank_2 30..120 CDD:289560
ANK repeat 55..87 CDD:293786
ANK repeat 89..120 CDD:293786
Ank_2 94..222 CDD:289560
ANK 117..244 CDD:238125
ANK repeat 190..222 CDD:293786
PulO <261..>367 CDD:224900 9/38 (24%)
zf-DHHC 394..521 CDD:279823 41/148 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.