DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18810 and dhhc-6

DIOPT Version :9

Sequence 1:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_502302.2 Gene:dhhc-6 / 178158 WormBaseID:WBGene00010892 Length:431 Species:Caenorhabditis elegans


Alignment Length:211 Identity:51/211 - (24%)
Similarity:78/211 - (36%) Gaps:65/211 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 CDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMIS-LTSSSI 162
            |..|.....|||.||.||..|.:..||||.:...|:||.|::||..||.:..:.|:.| :...|.
 Worm   108 CVPCNGFKVPRSHHCSKCDRCCMKMDHHCPWINNCVGHRNHQYFLRFLFFSVVGCIHSTIIDGSA 172

  Fly   163 FIYVLHGGRYQ--------LFMLTHPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVFVLLWIGVC 219
            ..:.:..|.||        :.:||   |.|  |.:|:..|         .:...:...|.::.:.
 Worm   173 LYHAIFAGWYQKYGDGTEPIILLT---PIS--FIALVFAI---------AMAIAVALALTFLFIT 223

  Fly   220 VATYVAYD---------------------------QW--SRGYFCYDFELQNIPFDRKLRRNFK- 254
            ...||..:                           :|  |.|.:.|       |:|...:||.: 
 Worm   224 QLRYVIRNRNGIEDYIHGKSLNMRKVHEGDDEEEIEWIKSLGEWTY-------PYDLGWKRNLRE 281

  Fly   255 TFLG-----RRMKWTW 265
            .|:|     .|...||
 Worm   282 VFIGIFDGRTRGNGTW 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 17/38 (45%)
dhhc-6NP_502302.2 zf-DHHC 102..240 CDD:279823 38/145 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.