Sequence 1: | NP_652670.2 | Gene: | CG18810 / 59171 | FlyBaseID: | FBgn0042133 | Length: | 300 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491702.1 | Gene: | dhhc-3 / 172257 | WormBaseID: | WBGene00018009 | Length: | 260 | Species: | Caenorhabditis elegans |
Alignment Length: | 204 | Identity: | 49/204 - (24%) |
---|---|---|---|
Similarity: | 85/204 - (41%) | Gaps: | 33/204 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 FLFILCGLPAIYYVLMEIILPELSDYWSPGYVFQLLLGLFLFSN----VMSNYVMCILVDPS--- 77
Fly 78 ----IDPKLMKNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHEN 138
Fly 139 YRYFFYFLIYFFLSCMISLTSSSIFIYVLHGGR--YQLFMLTHPAPNSAYFNSLIIRIIYFKLPD 201
Fly 202 IYELVFTLV 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18810 | NP_652670.2 | zf-DHHC | 92..>138 | CDD:303066 | 15/45 (33%) |
dhhc-3 | NP_491702.1 | zf-DHHC | 86..211 | CDD:279823 | 35/114 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |